Glycine Receptor Alpha 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18698825UL

Catalog No. NB418572

Description

Glycine Receptor Alpha 1 Polyclonal specifically detects Glycine Receptor Alpha 1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Glycine Receptor Alpha 1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: GLRA 1, Glycine receptor 48 kDa subunit, Glycine receptor strychnine-binding subunit, glycine receptor subunit alpha-1, glycine receptor, alpha 1, glycine receptor, alpha 1 (startle disease/hyperekplexia), MGC138878, MGC138879, STHE
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GLRA1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LLRFRRKRRHHKEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRAKKIDK
• Quantity: 25 μL
• Research Discipline: Diabetes Research, Neuronal Cell Markers, Neuroscience, Neurotransmission
• Gene ID (Entrez): 2741
• Target Species: Human
• Isotype: IgG

For Research Use Only