Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Glycine Receptor Alpha 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $648.50
Specifications
| Antigen | Glycine Receptor Alpha 1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Glycine Receptor Alpha 1 Polyclonal specifically detects Glycine Receptor Alpha 1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Glycine Receptor Alpha 1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| GLRA 1, Glycine receptor 48 kDa subunit, Glycine receptor strychnine-binding subunit, glycine receptor subunit alpha-1, glycine receptor, alpha 1, glycine receptor, alpha 1 (startle disease/hyperekplexia), MGC138878, MGC138879, STHE | |
| GLRA1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Diabetes Research, Neuronal Cell Markers, Neuroscience, Neurotransmission | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 2741 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LLRFRRKRRHHKEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRAKKIDK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title