Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Glycogenin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP17929120UL

View more versions of this product

Catalog No. NBP1792920

Description

Glycogenin 1 Polyclonal specifically detects Glycogenin 1 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	Glycogenin 1
Classification	Polyclonal
Dilution	Western Blot 1:1000
Gene Accession No.	NP_038783
Gene Symbols	GYG1
Immunogen	Synthetic peptide directed towards the C terminal of human Gyg. Peptide sequence SDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ.
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	2992
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	EC 2.4.1.186, glycogenin, glycogenin 1, glycogenin-1, GN1, GN-1, GSD15, GYG
Host Species	Rabbit
Molecular Weight of Antigen	37 kDa
Quantity	20 μL
Primary or Secondary	Primary
Target Species	Mouse
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

Glycogenin 1 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions