Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Glycogenin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17929120UL
Description
Glycogenin 1 Polyclonal specifically detects Glycogenin 1 in Mouse samples. It is validated for Western Blot.Specifications
Glycogenin 1 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_038783 | |
GYG1 | |
Synthetic peptide directed towards the C terminal of human Gyg. Peptide sequence SDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ. | |
Affinity Purified | |
RUO | |
2992 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 2.4.1.186, glycogenin, glycogenin 1, glycogenin-1, GN1, GN-1, GSD15, GYG | |
Rabbit | |
37 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction