Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Glycogenin 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$499.50
Specifications
| Antigen | Glycogenin 1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179291
|
Novus Biologicals
NBP179291 |
100 μL |
Each for $499.50
|
|
|||||
|
NBP1792920
|
Novus Biologicals
NBP17929120UL |
20 μL | N/A | N/A | N/A | ||||
Description
Glycogenin 1 Polyclonal specifically detects Glycogenin 1 in Human, Mouse samples. It is validated for Western Blot.Specifications
| Glycogenin 1 | |
| Polyclonal | |
| Rabbit | |
| NP_038783 | |
| 2992 | |
| Synthetic peptide directed towards the C terminal of human Gyg. Peptide sequence SDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.4.1.186, glycogenin, glycogenin 1, glycogenin-1, GN1, GN-1, GSD15, GYG | |
| GYG1 | |
| IgG | |
| 37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title