Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Glycogenin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | Glycogenin 1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179291
![]() |
Novus Biologicals
NBP179291 |
100 μL |
Each for $499.50
|
|
|||||
NBP1792920
![]() |
Novus Biologicals
NBP17929120UL |
20 μL | N/A | N/A | N/A | ||||
Description
Glycogenin 1 Polyclonal specifically detects Glycogenin 1 in Human, Mouse samples. It is validated for Western Blot.Specifications
Glycogenin 1 | |
Polyclonal | |
Rabbit | |
NP_038783 | |
2992 | |
Synthetic peptide directed towards the C terminal of human Gyg. Peptide sequence SDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 2.4.1.186, glycogenin, glycogenin 1, glycogenin-1, GN1, GN-1, GSD15, GYG | |
GYG1 | |
IgG | |
37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title