Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Glypican 3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP236558 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP236558 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP236558 Supplier Novus Biologicals Supplier No. NBP236558
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Glypican 3 Polyclonal specifically detects Glypican 3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Glypican 3
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 4.0 - 8.0 ug/ml, Immunohistochemistry-Paraffin
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P51654
Gene Alias DGSX, glypican 3, glypican proteoglycan 3, glypican-3, GTR2-2, heparan sulphate proteoglycan, Intestinal protein OCI-5, MXR7, OCI5, OCI-5, secreted glypican-3, SGB, SGBS, SGBS1SDYS
Gene Symbols GPC3
Host Species Rabbit
Immunogen The immunogen for Glypican 3 antibody: synthetic peptide directed towards the middle region of human Glypican 3. Peptide sequence: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
Molecular Weight of Antigen 64 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2719
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.