Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GM130/GOLGA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications
Supplier: Novus Biologicals NBP18975625UL
Description
GM130/GOLGA2 Polyclonal specifically detects GM130/GOLGA2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
GM130/GOLGA2 | |
Polyclonal | |
Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated | |
130 kDa cis-Golgi matrix protein, GM130 autoantigen, GM130Golgi matrix protein GM130, golgi autoantigen, golgin subfamily a, 2, golgin A2, Golgin subfamily A member 2, golgin-95, MGC20672, SY11 protein | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
GOLGA2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKE | |
25 μL | |
Cellular Markers, Golgi Apparatus Markers | |
2801 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction