Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GM130/GOLGA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications
$416.50 - $682.00
Specifications
Antigen | GM130/GOLGA2 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
GM130/GOLGA2 Polyclonal specifically detects GM130/GOLGA2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
GM130/GOLGA2 | |
Polyclonal | |
Rabbit | |
Cellular Markers, Golgi Apparatus Markers | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
2801 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKE | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
130 kDa cis-Golgi matrix protein, GM130 autoantigen, GM130Golgi matrix protein GM130, golgi autoantigen, golgin subfamily a, 2, golgin A2, Golgin subfamily A member 2, golgin-95, MGC20672, SY11 protein | |
GOLGA2 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title