Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GNB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15530720UL
Description
GNB1 Polyclonal specifically detects GNB1 in Human, Rat samples. It is validated for Western Blot.Specifications
GNB1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P62873 | |
GNB1 | |
Synthetic peptides corresponding to GNB1(guanine nucleotide binding protein (G protein), beta polypeptide 1) The peptide sequence was selected from the N terminal of GNB1. Peptide sequence MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT | |
Affinity Purified | |
RUO | |
2782 | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
beta subunit, signal-transducing proteins GS/GI, G protein, beta-1 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 1, guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1, guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1, Transducin beta chain 1 | |
Rabbit | |
37 kDa | |
20 μL | |
Primary | |
This product is specific to Subunit or Isoform: beta-1. | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction