Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GNB1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen GNB1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15530820
View Documents
Novus Biologicals
NBP15530820UL
20 μL
Each for $152.22
Add to cart
 
NBP155308
View Documents
Novus Biologicals
NBP155308
100 μL
Each for $436.00
Add to cart
 
Description

Description

GNB1 Polyclonal specifically detects GNB1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

GNB1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
beta subunit, signal-transducing proteins GS/GI, G protein, beta-1 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 1, guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1, guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1, Transducin beta chain 1
GNB1
IgG
Affinity Purified
This product is specific to Subunit or Isoform: beta-1.
Western Blot
Unconjugated
RUO
P62873
2782
Synthetic peptides corresponding to GNB1(guanine nucleotide binding protein (G protein), beta polypeptide 1) The peptide sequence was selected from the C terminal of GNB1. Peptide sequence DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKAD
Primary
Store at -20C. Avoid freeze-thaw cycles.
37 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit