Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP181787

GNB1L Antibody, Novus Biologicals™
SDP

Catalog No. NBP181787 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP181787 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP181787 Supplier Novus Biologicals Supplier No. NBP181787

Description

Rabbit Polyclonal Antibody

GNB1L Polyclonal specifically detects GNB1L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen GNB1L
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias DGCRK3, G-protein beta subunit-like protein, guanine nucleotide binding protein (G protein), beta polypeptide 1-like, guanine nucleotide binding protein beta-subunit-like polypeptide, guanine nucleotide-binding protein subunit beta-like protein 1, GY2WD40 repeat-containing protein deleted in VCFS, KIAA1645, WD repeat-containing protein 14, WDR14G protein subunit beta-like protein 1, WDVCF
Gene Symbols GNB1L
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVL
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 54584
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.