GNB1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP181787

Catalog No. NBP181787

Description

GNB1L Polyclonal specifically detects GNB1L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GNB1L
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: DGCRK3, G-protein beta subunit-like protein, guanine nucleotide binding protein (G protein), beta polypeptide 1-like, guanine nucleotide binding protein beta-subunit-like polypeptide, guanine nucleotide-binding protein subunit beta-like protein 1, GY2WD40 repeat-containing protein deleted in VCFS, KIAA1645, WD repeat-containing protein 14, WDR14G protein subunit beta-like protein 1, WDVCF
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GNB1L
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVL
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 54584
• Target Species: Human
• Isotype: IgG

For Research Use Only