GOLGA5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160047

Catalog No. NBP160047

Description

GOLGA5 Polyclonal specifically detects GOLGA5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GOLGA5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cell proliferation-inducing gene 31 protein, golgi autoantigen, golgin subfamily a, 5, golgin A5, Golgin subfamily A member 5, Golgin-84, GOLIM5, Protein Ret-II, PTC5, RET-fused gene 5 protein, ret-II, RETII, rfg5, RFG5golgi integral membrane protein 5
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 100%; Bovine: 92%; Canine: 92%; Equine: 92%; Pig: 92%; Chicken: 76%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TBA6
• Gene Symbols: GOLGA5
• Immunogen: Synthetic peptides corresponding to GOLGA5(golgi autoantigen, golgin subfamily a, 5) The peptide sequence was selected from the N terminal of GOLGA5. Peptide sequence FVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVS.
• Quantity: 100 μL
• Research Discipline: Golgi Apparatus Markers
• Gene ID (Entrez): 9950
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.