GOLGA6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25471625UL

Catalog No. NB395286

Description

GOLGA6 Polyclonal specifically detects GOLGA6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GOLGA6
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: FLJ75859, GLPGolgin-like protein, GOLGA6Golgin linked to PML, golgi autoantigen, golgin subfamily a, 6, golgi autoantigen, golgin subfamily a, 6A, golgi autoantigen, golgin subfamily a, member 6, golgin A6 family, member A, Golgin subfamily A member 6A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 342096
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: GOLGA6A
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:GVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLA
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only