GOLGA7 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP153153	100 μL

Catalog No. NBP153153 Supplier Novus Biologicals Supplier No. NBP153153

Description

Rabbit Polyclonal Antibody

GOLGA7 Polyclonal specifically detects GOLGA7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GOLGA7
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q7Z5G4
• Gene Alias: GCP16MGC21096, GOLGA3AP1, GOLGA7A, golgi autoantigen, golgin subfamily a, 7, Golgi complex-associated protein of 16 kDa, Golgi complex-associated protein of 16kDa, golgin A7, Golgin subfamily A member 7, HSPC041, MGC4876
• Gene Symbols: GOLGA7
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to GOLGA7(golgi autoantigen, golgin subfamily a, 7) The peptide sequence was selected from the middle region of GOLGA7. Peptide sequence ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGL.
• Molecular Weight of Antigen: 16 kDa
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 51125
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only