GOLGA7B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156754

Catalog No. NBP156754

Description

GOLGA7B Polyclonal specifically detects GOLGA7B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GOLGA7B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: bA451M19.3, bA459F3.4, C10orf132, C10orf133, chromosome 10 open reading frame 132, chromosome 10 open reading frame 133, golgi autoantigen, golgin subfamily a, 7B, golgin A7 family, member B, Golgin subfamily A member 7B, MGC131701
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 401647
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q2TAP0
• Gene Symbols: GOLGA7B
• Immunogen: Synthetic peptides corresponding to C10ORF132 The peptide sequence was selected from the N terminal of C10ORF132. Peptide sequence MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Mouse: 100%; Human: 100%; Zebrafish: 92%; Green puffer: 85%; Southern house mosquito: 78%; Florida lancelet: 78%; Yellowfever mosquito: 78%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG