GPER/GPR30 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP188096

Catalog No. NBP188096

Description

GPER/GPR30 Polyclonal specifically detects GPER/GPR30 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GPER/GPR30
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q99527
• Gene Symbols: GPER1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CEPRG-protein coupled receptor 30, Chemoattractant receptor-like 2, chemokine receptor-like 2, CMKRL2MGC99678, constitutively expressed peptide-like receptor, DRY12IL8-related receptor DRY12, FEG-1mER, Flow-induced endothelial G-protein coupled receptor 1, G protein-coupled estrogen receptor 1, G protein-coupled receptor 30, GPCR-BR, GPR30GPCR-Br, G-protein coupled estrogen receptor 1, heptahelix receptor, LERGU, LERGU2, leucine rich protein in GPR30 3'UTR, LyGPR, Lymphocyte-derived G-protein coupled receptor, Membrane estrogen receptor
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 0.1 mL
• Research Discipline: Breast Cancer, Cancer, GPCR, Neuroscience
• Gene ID (Entrez): 2852
• Target Species: Human
• Isotype: IgG

For Research Use Only