Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GPN2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15535920UL
Description
GPN2 Polyclonal specifically detects GPN2 in Human samples. It is validated for Western Blot.Specifications
GPN2 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9H9Y4 | |
GPN2 | |
Synthetic peptides corresponding to GPN2 (GPN-loop GTPase 2) The peptide sequence was selected from the middle region of GPN2. Peptide sequence VLQAVDKANGYCFRAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSN. | |
Affinity Purified | |
RUO | |
54707 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ATP binding domain 1 family, member B, ATPBD1B, ATP-binding domain 1 family member B, FLJ10349, GPN-loop GTPase 2 | |
Rabbit | |
34 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction