Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GPR155 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25611825UL
Description
GPR155 Polyclonal specifically detects GPR155 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
GPR155 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
DEP.7, DEPDC3, FLJ31819, FLJ39346, G protein-coupled receptor 155, integral membrane protein GPR155, PGR22G-protein coupled receptor PGR22 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
GPR155 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VVEPGNTAFEESPAPVNEPELFTSSIPETSCCSCSMGNGELHCPSIEPIANTSTSEPVIPSFEKNNHCVSRCNSQSCILAQEEEQYLQ | |
25 μL | |
Cancer, Neuroscience, Signal Transduction, Stem Cell Lines | |
151556 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction