Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GPR87 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | GPR87 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
GPR87 Polyclonal specifically detects GPR87 in Human samples. It is validated for Western Blot.Specifications
GPR87 | |
Polyclonal | |
Rabbit | |
GPCR | |
G protein-coupled receptor 87, G protein-coupled receptor 95, GPR95, G-protein coupled receptor 87, G-protein coupled receptor 95, KPG_002, MGC131898, orphan GPCR 87 | |
GPR87 | |
IgG | |
41 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9BY21 | |
53836 | |
Synthetic peptides corresponding to GPR87 (G protein-coupled receptor 87) The peptide sequence was selected from the middle region of GPR87)(50ug). Peptide sequence NQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title