Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GPR88 Antibody, Novus Biologicals™
SDP

Catalog No. NBP18050820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP18050820 20 μL
NBP180508 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP18050820 Supplier Novus Biologicals Supplier No. NBP18050820UL

Rabbit Polyclonal Antibody

GPR88 Polyclonal specifically detects GPR88 in Rat samples. It is validated for Western Blot.

Specifications

Antigen GPR88
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_113884
Gene Alias G protein coupled receptor 88, G protein-coupled receptor 88, G-protein coupled receptor 88, probable G-protein coupled receptor 88, STRG, Striatum-specific G-protein coupled receptor
Gene Symbols GPR88
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human Gpr88. Peptide sequence LYTWRNEEFRRSVRSVLPGVGDAAAAAAAATAVPAMSQAQLGTRAAGQHW.
Molecular Weight of Antigen 40 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54112
Target Species Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.