GPRC5C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18715925UL

Catalog No. NB406195

Description

GPRC5C Polyclonal specifically detects GPRC5C in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GPRC5C
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9NQ84
• Gene Symbols: GPRC5C
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRN
• Quantity: 25 μL
• Research Discipline: GPCR
• Gene ID (Entrez): 55890
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: G protein-coupled receptor, family C, group 5, member C, MGC131820, RAIG-3G-protein coupled receptor family C group 5 member C, RAIG3orphan G-protein coupled receptor, retinoic acid responsive gene protein, Retinoic acid-induced gene 3 protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only