Granzyme K Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24938725UL

Catalog No. NB395704

Description

Granzyme K Polyclonal antibody specifically detects Granzyme K in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Granzyme K
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: EC 3.4.21, EC 3.4.21.-, EC 3.4.21.4, Fragmentin-3, granzyme 3, granzyme K, granzyme K (granzyme 3; tryptase II), granzyme K (serine protease, granzyme 3; tryptase II), Granzyme-3, NK-Tryp-2, NK-tryptase-2, PRSS, TRYP2granzyme-3, tryptase II
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDS
• Quantity: 25 μL
• Research Discipline: Apoptosis, Immunology
• Gene ID (Entrez): 3003
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified