GRASP55 Antibody (CL2522), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP23676925UL

Catalog No. NB397075

Description

GRASP55 Monoclonal specifically detects GRASP55 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GRASP55
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Golgi phosphoprotein 6, golgi reassembly stacking protein 2, 55 kDa, golgi reassembly stacking protein 2, 55kDa, Golgi reassembly-stacking protein of 55 kDa, GOLPH6DKFZp434D156, GRASP55FLJ13139, GRS2Golgi reassembly-stacking protein 2, p59
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry
• Clone: CL2522
• Dilution: Western Blot 1:500-1:1000, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000-1:10000
• Gene Accession No.: Q9H8Y8
• Gene Symbols: GORASP2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV
• Quantity: 25 μL
• Research Discipline: Golgi Apparatus Markers
• Gene ID (Entrez): 26003
• Reconstitution: Protein A purified
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG1

For Research Use Only