Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GRASP55 Antibody (CL2522), Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP236769
Description
GRASP55 Monoclonal specifically detects GRASP55 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
GRASP55 | |
Monoclonal | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
Golgi phosphoprotein 6, golgi reassembly stacking protein 2, 55 kDa, golgi reassembly stacking protein 2, 55kDa, Golgi reassembly-stacking protein of 55 kDa, GOLPH6DKFZp434D156, GRASP55FLJ13139, GRS2Golgi reassembly-stacking protein 2, p59 | |
Mouse | |
Protein A purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Human | |
Purified |
Western Blot, Immunohistochemistry | |
CL2522 | |
Western Blot 1:500-1:1000, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000-1:10000 | |
Q9H8Y8 | |
GORASP2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV | |
0.1 mL | |
Golgi Apparatus Markers | |
26003 | |
Protein A purified | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction