GRK4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155313

Catalog No. NBP155313

Description

GRK4 Polyclonal specifically detects GRK4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GRK4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.7.11, EC 2.7.11.16, G protein-coupled receptor kinase 2-like (Drosophila), G protein-coupled receptor kinase 4, G protein-coupled receptor kinase GRK4, GPRK2LIT11, GPRK4GRK4a, G-protein coupled receptor kinase 4, ITI1
• Host Species: Rabbit
• Molecular Weight of Antigen: 59 kDa
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 2868
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P32298
• Gene Symbols: GRK4
• Immunogen: Synthetic peptides corresponding to GRK4(G protein-coupled receptor kinase 4) The peptide sequence was selected from the middle region of GRK4. Peptide sequence QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.