Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GRK4 Antibody, Novus Biologicals™

GRK4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15531320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15531320 20 μL
NBP155313 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15531320 Supplier Novus Biologicals Supplier No. NBP15531320UL

Description

Rabbit Polyclonal Antibody

GRK4 Polyclonal specifically detects GRK4 in Human samples. It is validated for Western Blot.

Specifications

Antigen GRK4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P32298
Gene Alias EC 2.7.11, EC 2.7.11.16, G protein-coupled receptor kinase 2-like (Drosophila), G protein-coupled receptor kinase 4, G protein-coupled receptor kinase GRK4, GPRK2LIT11, GPRK4GRK4a, G-protein coupled receptor kinase 4, ITI1
Gene Symbols GRK4
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GRK4(G protein-coupled receptor kinase 4) The peptide sequence was selected from the middle region of GRK4. Peptide sequence QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY.
Molecular Weight of Antigen 59 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 2868
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.