Learn More
Description
Specifications
Specifications
| Antigen | GRWD1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | CDW4, CUL4- and DDB1-associated WDR protein 4, glutamate-rich WD repeat containing 1, GRWDglutamate rich WD repeat protein GRWD, KIAA1942regulator of ribosome biogenesis 1 homolog, RRB1, WD repeat domain 28, WDR28glutamate-rich WD repeat-containing protein 1 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GRWD1 (NP_113673.3). Peptide sequence SADASIRIWDIRAAPSKACMLTTATAHDGDVNVISWSRREPFLLSGGDDG |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
