Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GSDMDC1 Antibody, Novus Biologicals™

GSDMDC1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP233422 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP233422 0.1 mL
NB436895 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP233422 Supplier Novus Biologicals Supplier No. NBP233422
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

GSDMDC1 Polyclonal antibody specifically detects GSDMDC1 in Human, Mouse, Rat, Porcine samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin), Immunoassay, Knockdown.

Specifications

Antigen GSDMDC1
Applications Western Blot, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin), Immunoassay, KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/mL, Immunocytochemistry/Immunofluorescence -Reactivity reported in scientific literature (PMID: 30250284)., Immunoprecipitation -Reported in scientific literature (PMID :33053349)., Immunohistochemistry-Paraffin -Reported in scientific literature (PMID:34494385)., Knockout Validated -Reactivity reported in scientific literature (PMID: 32796818)., Knockdown Validated -Reactivity reported in scientific literature (PMID: 31216481)
Formulation PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P57764
Gene Alias DF5L, DFNA5L, FLJ12150, gasdermin D, gasdermin domain containing 1, Gasdermin domain-containing protein 1, gasdermin-D, GSDMDC1
Gene Symbols GSDMD
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTS
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79792
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat, Pig
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.