Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GSG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15643520UL
Description
GSG1 Polyclonal specifically detects GSG1 in Human, Mouse samples. It is validated for Western Blot.Specifications
GSG1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q2KHT4 | |
GSG1 | |
Synthetic peptides corresponding to GSG1(germ cell associated 1) The peptide sequence was selected from the N terminal of GSG1. Peptide sequence NYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGD. | |
20 μL | |
Primary | |
Human, Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
germ cell associated 1, germ cell-specific gene 1 protein, MGC111023, MGC3146 | |
Rabbit | |
Affinity Purified | |
RUO | |
83445 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction