GSG2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179837

Catalog No. NBP179837

Description

GSG2 Polyclonal specifically detects GSG2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GSG2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.7.11.1, germ cell associated 2 (haspin), Germ cell-specific gene 2 protein, Haploid germ cell-specific nuclear protein kinase, HASPIN, H-haspin, serine/threonine-protein kinase haspin
• Host Species: Rabbit
• Molecular Weight of Antigen: 88 kDa
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 83903
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_114171
• Gene Symbols: GSG2
• Immunogen: The immunogen for this antibody is GSG2. Peptide sequence SQEEATGGAKDTRMVHQTRASLRSVLFGLMNSGTPEDSEFRADGKNMRES.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 79%.
• Target Species: Human, Canine
• Isotype: IgG