Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GSG2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | GSG2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
GSG2 Polyclonal specifically detects GSG2 in Human samples. It is validated for Western Blot.Specifications
GSG2 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication | |
EC 2.7.11.1, germ cell associated 2 (haspin), Germ cell-specific gene 2 protein, Haploid germ cell-specific nuclear protein kinase, HASPIN, H-haspin, serine/threonine-protein kinase haspin | |
GSG2 | |
IgG | |
88 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_114171 | |
83903 | |
The immunogen for this antibody is GSG2. Peptide sequence SQEEATGGAKDTRMVHQTRASLRSVLFGLMNSGTPEDSEFRADGKNMRES. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title