Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GSPT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $501.50
Specifications
| Antigen | GSPT2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15764620
|
Novus Biologicals
NBP15764620UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP157646
|
Novus Biologicals
NBP157646 |
100 μL |
Each for $501.50
|
|
|||||
Description
GSPT2 Polyclonal specifically detects GSPT2 in Human samples. It is validated for Western Blot.Specifications
| GSPT2 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| eRF3b, ERF3BGST2, eukaryotic peptide chain release factor GTP-binding subunit ERF3B, Eukaryotic peptide chain release factor subunit 3b, FLJ10441, G1 to S phase transition 2, G1 to S phase transition protein 2 homolog | |
| GSPT2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8IYD1 | |
| 23708 | |
| Synthetic peptides corresponding to GSPT2 (G1 to S phase transition 2) The peptide sequence was selected from the middle region of GSPT2)(50ug). Peptide sequence GANIKEQSDFCPWYTGLPFIPYLDNLPNFNRSIDGPIRLPIVDKYKDMGT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title