Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GSTO2 Antibody, Novus Biologicals™

GSTO2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP154580 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP154580 100 μL
NBP15458020 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP154580 Supplier Novus Biologicals Supplier No. NBP154580
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

GSTO2 Polyclonal specifically detects GSTO2 in Human samples. It is validated for Western Blot.

Specifications

Antigen GSTO2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9H4Y5
Gene Alias bA127L20.1, bA127L20.1 (novel glutathione-S-transferase), EC 2.5.1.18, glutathione S-transferase omega 2, glutathione S-transferase omega-2, glutathione-S-transferase-like protein, GSTO-2
Gene Symbols GSTO2
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle of human GSTO2. Peptide Sequence VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV. The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 28 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 119391
Test Specificity Yeast: 77%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.