Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GTF2A1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | GTF2A1L |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
GTF2A1L Polyclonal specifically detects GTF2A1L in Human samples. It is validated for Western Blot.Specifications
GTF2A1L | |
Polyclonal | |
Rabbit | |
1-like factor, general transcription factor IIA, 1-like, GTF2A1LF, MGC26254, TFIIA large subunit isoform ALF, TFIIA-alpha and beta-like factor, TFIIA-alpha/beta-like factor | |
GTF2A1L | |
IgG | |
49 kDa |
Western Blot | |
Unconjugated | |
RUO | |
11036 | |
Synthetic peptides corresponding to GTF2A1L (general transcription factor IIA, 1-like) The peptide sequence was selected from the C terminal of GTF2A1L. Peptide sequence EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title