Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GTF3C6 Antibody, Novus Biologicals™

GTF3C6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP231851 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP231851 0.1 mL
NB437170 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP231851 Supplier Novus Biologicals Supplier No. NBP231851
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

GTF3C6 Polyclonal specifically detects GTF3C6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen GTF3C6
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q969F1
Gene Alias bA397G5.3, C6orf51chromosome 6 open reading frame 51, general transcription factor 3C polypeptide 6, general transcription factor IIIC, polypeptide 6, alpha 35kDa, TFIIIC35TFIIIC 35 kDa subunit, Transcription factor IIIC 35 kDa subunit, transcription factor IIIC 35kDa, Transcription factor IIIC subunit 6
Gene Symbols GTF3C6
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 112495
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.