Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GTPBP10 Antibody, Novus Biologicals™

GTPBP10 Antibody, Novus Biologicals™
SDP

Catalog No. NBP152959 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP152959 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP152959 Supplier Novus Biologicals Supplier No. NBP152959
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

GTPBP10 Polyclonal specifically detects GTPBP10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen GTPBP10
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. A4D1E9
Gene Alias DKFZP686A10121, FLJ38242, GTP-binding protein 10, GTP-binding protein 10 (putative), MGC104191, ObgH2, Protein obg homolog 2
Gene Symbols GTPBP10
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GTPBP10(GTP-binding protein 10 (putative)) The peptide sequence was selected from the middle region of GTPBP10. Peptide sequence IILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFL.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 85865
Test Specificity Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Canine: 92%; Guinea pig: 92%; Chicken: 85%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.