Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GUF1 Antibody, Novus Biologicals™

GUF1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17968320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17968320 20 μL
NBP179683 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17968320 Supplier Novus Biologicals Supplier No. NBP17968320UL

Description

Rabbit Polyclonal Antibody

GUF1 Polyclonal specifically detects GUF1 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen GUF1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_766299
Gene Alias EC 3.6.5.-, EF-4, Elongation factor 4 homolog, FLJ13220, GTPase GUF1, GTPase of unknown function 1, GTP-binding protein GUF1 homolog, GUF1 GTPase homolog (S. cerevisiae), Ribosomal back-translocase, translation factor GUF1, mitochondrial
Gene Symbols GUF1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human Guf1The immunogen for this antibody is Guf1. Peptide sequence YLFPLNEIVVDFYDSLKSLSSGYASFDYEDAGYQTAELVKMDILLNGNMV.
Molecular Weight of Antigen 72 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 60558
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.