Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HA95/AKAP8L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24744125UL
Description
HA95/AKAP8L Polyclonal specifically detects HA95/AKAP8L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| HA95/AKAP8L | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| A kinase (PRKA) anchor protein 8-like, AKAP8-like protein, HA95, HAP95 DKFZp434L0650, helicase A-binding protein 95 kDa, Homologous to AKAP95 protein, HRIHFB2018, NAKAP, NAKAP95 A-kinase anchor protein 8-like, neighbor of A kinase anchoring protein 95, Neighbor of AKAP95, Neighbor of A-kinase-anchoring protein 95 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of HA95/AKAP8L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| AKAP8L | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FLQEYVTNKTKKTEELRKTVEDLDGLIQQIYRDQDLTQEIAMEHFVKKVEAAHCAACDLFIPMQFGIIQKHLKTMDHNRNRR | |
| 25 μL | |
| Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Neuroscience | |
| 26993 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction