HA95/AKAP8L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP247441	Novus Biologicals NBP247441	0.1 mL
NB404521	Novus Biologicals NBP24744125UL	25 μL

Description

HA95/AKAP8L Polyclonal specifically detects HA95/AKAP8L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HA95/AKAP8L
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: A kinase (PRKA) anchor protein 8-like, AKAP8-like protein, HA95, HAP95 DKFZp434L0650, helicase A-binding protein 95 kDa, Homologous to AKAP95 protein, HRIHFB2018, NAKAP, NAKAP95 A-kinase anchor protein 8-like, neighbor of A kinase anchoring protein 95, Neighbor of AKAP95, Neighbor of A-kinase-anchoring protein 95
• Gene Symbols: AKAP8L
• Isotype: IgG
• Purification Method: Affinity Purified

• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Neuroscience
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 26993
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FLQEYVTNKTKKTEELRKTVEDLDGLIQQIYRDQDLTQEIAMEHFVKKVEAAHCAACDLFIPMQFGIIQKHLKTMDHNRNRR
• Primary or Secondary: Primary
• Test Specificity: Specificity of HA95/AKAP8L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only