Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HAO2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317862100UL
This item is not returnable.
View return policy
Description
HAO2 Polyclonal antibody specifically detects HAO2 in Human samples. It is validated for Western BlotSpecifications
HAO2 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml | |
(S)-2-hydroxy-acid oxidase, peroxisomal, Cell growth-inhibiting gene 16 protein, EC 1.1.3.15, GIG16, growth-inhibiting protein 16, HAOX2glycolate oxidase, hydroxyacid oxidase 2, hydroxyacid oxidase 2 (long chain), Long chain alpha-hydroxy acid oxidase, Long-chain L-2-hydroxy acid oxidase | |
This antibody was developed against Recombinant Protein corresponding to amino acids: RHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSWFQSITRLPIILKGILTKEDAELAVKHNVQG | |
100 μg | |
Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction | |
51179 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction