Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HAO2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$353.00 - $573.00
Specifications
Antigen | HAO2 |
---|---|
Dilution | Western Blot 0.04-0.4 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
HAO2 Polyclonal antibody specifically detects HAO2 in Human samples. It is validated for Western BlotSpecifications
HAO2 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction | |
PBS, pH 7.2, 40% glycerol | |
51179 | |
IgG | |
Affinity purified |
Western Blot 0.04-0.4 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
(S)-2-hydroxy-acid oxidase, peroxisomal, Cell growth-inhibiting gene 16 protein, EC 1.1.3.15, GIG16, growth-inhibiting protein 16, HAOX2glycolate oxidase, hydroxyacid oxidase 2, hydroxyacid oxidase 2 (long chain), Long chain alpha-hydroxy acid oxidase, Long-chain L-2-hydroxy acid oxidase | |
This antibody was developed against Recombinant Protein corresponding to amino acids: RHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSWFQSITRLPIILKGILTKEDAELAVKHNVQG | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title