Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HARBI1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17423020UL
Description
HARBI1 Polyclonal specifically detects HARBI1 in Mouse samples. It is validated for Western Blot.Specifications
HARBI1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
C11orf77, chromosome 11 open reading frame 77, EC 3.1, FLJ32675, harbinger transposase derived 1, Harbinger transposase-derived nuclease, putative nuclease HARBI1 | |
Rabbit | |
27 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
HARBI1 | |
Synthetic peptides corresponding to the N terminal of Harbi1. Immunizing peptide sequence ITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYFLVELLG. | |
Affinity Purified | |
RUO | |
283254 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction