Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HARBI1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25568025UL
Description
HARBI1 Polyclonal specifically detects HARBI1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
HARBI1 | |
Polyclonal | |
Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
C11orf77, chromosome 11 open reading frame 77, EC 3.1, FLJ32675, harbinger transposase derived 1, Harbinger transposase-derived nuclease, putative nuclease HARBI1 | |
Rabbit | |
Affinity Purified | |
RUO | |
283254 | |
Human | |
IgG |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
HARBI1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSV | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction