HAX-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154800

Catalog No. NBP154800

Description

HAX-1 Polyclonal specifically detects HAX-1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

• Antigen: HAX-1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ17042, FLJ93803, HAX-1, HCLS1 (and PKD2) associated protein, HCLS1 associated protein X-1, HCLS1-associated protein X-1, HCLSBP1, HS1 binding protein, HS1-associating protein X-1, HS1-binding protein 1, HS1BP1FLJ18492, HSP1BP-1, SCN3
• Host Species: Rabbit
• Molecular Weight of Antigen: 31 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: O00165
• Gene Symbols: HAX1
• Immunogen: Synthetic peptides corresponding to HAX1(HCLS1 associated protein X-1) The peptide sequence was selected from the middle region of HAX1. Peptide sequence LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10456
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG