HBQ1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238960

Catalog No. NBP238960

Description

HBQ1 Polyclonal specifically detects HBQ1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HBQ1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: P09105
• Gene Symbols: HBQ1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RHYPGDFSPALQASLDKFLSHVISALVSEYR
• Quantity: 0.1 mL
• Research Discipline: Cardiovascular Biology
• Gene ID (Entrez): 3049
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: hemoglobin subunit theta-1, Hemoglobin theta-1 chain, hemoglobin, theta 1, theta-1-globin
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.