HBS1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152835

Catalog No. NBP152835

Description

HBS1L Polyclonal specifically detects HBS1L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence.

Specifications

• Antigen: HBS1L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp434g247, ERF3-similar protein, ERFSDKFZp686L13262, HBS1 (S. cerevisiae)-like, HBS1KIAA1038EF-1a, HBS1-like (S. cerevisiae), HBS1-like protein, Hsp70 subfamily B suppressor 1-like protein, HSPC276
• Host Species: Rabbit
• Molecular Weight of Antigen: 22 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 10767
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Gene Accession No.: Q9Y450
• Gene Symbols: HBS1L
• Immunogen: Synthetic peptides corresponding to HBS1L(HBS1-like (S. cerevisiae)) The peptide sequence was selected from the C terminal of HBS1L. Peptide sequence MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.