Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HBS1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	HBS1L
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP152835 View Documents View Product Certificates	Novus Biologicals NBP152835	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

HBS1L Polyclonal specifically detects HBS1L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence.

Specifications

Antigen	HBS1L
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q9Y450
Gene ID (Entrez)	10767
Immunogen	Synthetic peptides corresponding to HBS1L(HBS1-like (S. cerevisiae)) The peptide sequence was selected from the C terminal of HBS1L. Peptide sequence MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH.
Primary or Secondary	Primary

Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Signal Transduction
Gene Alias	DKFZp434g247, ERF3-similar protein, ERFSDKFZp686L13262, HBS1 (S. cerevisiae)-like, HBS1KIAA1038EF-1a, HBS1-like (S. cerevisiae), HBS1-like protein, Hsp70 subfamily B suppressor 1-like protein, HSPC276
Gene Symbols	HBS1L
Isotype	IgG
Molecular Weight of Antigen	22 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

HBS1L Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents