HCFC1R1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP231788

Catalog No. NBP231788

Description

HCFC1R1 Polyclonal specifically detects HCFC1R1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HCFC1R1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q9NWW0
• Gene Symbols: HCFC1R1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEEN
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: FLJ20568, HCF-1 beta-propeller interacting protein, HCF-1 beta-propeller-interacting protein, host cell factor C1 regulator 1, host cell factor C1 regulator 1 (XPO1 dependant), host cell factor C1 regulator 1 (XPO1 dependent), HPIPMGC99622, MGC70711
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54985
• Target Species: Human
• Isotype: IgG

For Research Use Only