Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HCFC1R1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | HCFC1R1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15307020
|
Novus Biologicals
NBP15307020UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP153070
|
Novus Biologicals
NBP153070 |
100 μL |
Each for $482.50
|
|
|||||
Description
HCFC1R1 Polyclonal specifically detects HCFC1R1 in Human samples. It is validated for Western Blot.Specifications
| HCFC1R1 | |
| Polyclonal | |
| Rabbit | |
| Q9NWW0 | |
| 54985 | |
| Synthetic peptides corresponding to HCFC1R1(host cell factor C1 regulator 1 (XPO1 dependent)) The peptide sequence was selected from the middle region of HCFC1R1. Peptide sequence LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ20568, HCF-1 beta-propeller interacting protein, HCF-1 beta-propeller-interacting protein, host cell factor C1 regulator 1, host cell factor C1 regulator 1 (XPO1 dependant), host cell factor C1 regulator 1 (XPO1 dependent), HPIPMGC99622, MGC70711 | |
| HCFC1R1 | |
| IgG | |
| 15 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title