Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HCFC1R1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen HCFC1R1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15307020
View Documents
Novus Biologicals
NBP15307020UL
20 μL
Each for $152.22
Add to cart
 
NBP153070
View Documents
Novus Biologicals
NBP153070
100 μL
Each for $436.00
Add to cart
 
Description

Description

HCFC1R1 Polyclonal specifically detects HCFC1R1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

HCFC1R1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
FLJ20568, HCF-1 beta-propeller interacting protein, HCF-1 beta-propeller-interacting protein, host cell factor C1 regulator 1, host cell factor C1 regulator 1 (XPO1 dependant), host cell factor C1 regulator 1 (XPO1 dependent), HPIPMGC99622, MGC70711
HCFC1R1
IgG
Affinity Purified
15 kDa
Western Blot
Unconjugated
RUO
Q9NWW0
54985
Synthetic peptides corresponding to HCFC1R1(host cell factor C1 regulator 1 (XPO1 dependent)) The peptide sequence was selected from the middle region of HCFC1R1. Peptide sequence LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit