Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HCFC1R1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | HCFC1R1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15307020
|
Novus Biologicals
NBP15307020UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP153070
|
Novus Biologicals
NBP153070 |
100 μL |
Each for $487.50
|
|
|||||
Description
HCFC1R1 Polyclonal specifically detects HCFC1R1 in Human samples. It is validated for Western Blot.Specifications
| HCFC1R1 | |
| Polyclonal | |
| Rabbit | |
| Q9NWW0 | |
| 54985 | |
| Synthetic peptides corresponding to HCFC1R1(host cell factor C1 regulator 1 (XPO1 dependent)) The peptide sequence was selected from the middle region of HCFC1R1. Peptide sequence LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ20568, HCF-1 beta-propeller interacting protein, HCF-1 beta-propeller-interacting protein, host cell factor C1 regulator 1, host cell factor C1 regulator 1 (XPO1 dependant), host cell factor C1 regulator 1 (XPO1 dependent), HPIPMGC99622, MGC70711 | |
| HCFC1R1 | |
| IgG | |
| 15 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title