Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HDAC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16912720UL
Description
HDAC6 Polyclonal specifically detects HDAC6 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
HDAC6 | |
Polyclonal | |
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:10-1:500 | |
EC 3.5.1.98, HD6FLJ16239, histone deacetylase 6, JM21, KIAA0901 | |
Rabbit | |
125 kDa | |
20 μL | |
Primary | |
Human, Mouse | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
HDAC6 | |
Synthetic peptides corresponding to Hdac6 (histone deacetylase 6) The peptide sequence was selected from the N terminal of Hdac6. Peptide sequence RQRKSRHNPQSPLQDSSATLKRGGKKGAVPHSSPNLAEVKKKGKMKKLSQ. | |
Affinity Purified | |
RUO | |
10013 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction