Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. HDAC6 Antibody, Novus Biologicals™

HDAC6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1692720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1692720 20 μL
NBP169127 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1692720 Supplier Novus Biologicals Supplier No. NBP16912720UL

Description

Rabbit Polyclonal Antibody

HDAC6 Polyclonal specifically detects HDAC6 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen HDAC6
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS & 2% Sucrose. with No Preservative
Gene Alias EC 3.5.1.98, HD6FLJ16239, histone deacetylase 6, JM21, KIAA0901
Gene Symbols HDAC6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Hdac6 (histone deacetylase 6) The peptide sequence was selected from the N terminal of Hdac6. Peptide sequence RQRKSRHNPQSPLQDSSATLKRGGKKGAVPHSSPNLAEVKKKGKMKKLSQ.
Molecular Weight of Antigen 125 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10013
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.