Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HDAC6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | HDAC6 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1692720
|
Novus Biologicals
NBP16912720UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP169127
|
Novus Biologicals
NBP169127 |
100 μL |
Each for $499.50
|
|
|||||
Description
HDAC6 Polyclonal specifically detects HDAC6 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| HDAC6 | |
| Unconjugated | |
| RUO | |
| 10013 | |
| Synthetic peptides corresponding to Hdac6 (histone deacetylase 6) The peptide sequence was selected from the N terminal of Hdac6. Peptide sequence RQRKSRHNPQSPLQDSSATLKRGGKKGAVPHSSPNLAEVKKKGKMKKLSQ. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| EC 3.5.1.98, HD6FLJ16239, histone deacetylase 6, JM21, KIAA0901 | |
| HDAC6 | |
| IgG | |
| 125 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title